DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and CG14160

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_648380.2 Gene:CG14160 / 39177 FlyBaseID:FBgn0036066 Length:483 Species:Drosophila melanogaster


Alignment Length:513 Identity:97/513 - (18%)
Similarity:180/513 - (35%) Gaps:129/513 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KY--QYLAAISVNIISISYGAFCGW-----PSSSFLELSSENSPLDTGPLTPTDQGWVASNICLG 65
            ||  |:.:..|.:|:.:..|....|     |:..||...:.::.:         ..|.     :|
  Fly    21 KYRLQFQSMASASIVFVGCGMRLAWSIFDTPAGKFLNNHNTHNLM---------MSWF-----IG 71

  Fly    66 GLVGTFLFTWLADRIGRKLCL----MWMALPNLLGWVIIPFARTPMHLIIARF----IGGAAGGG 122
            ..||..|......|:.:.:..    ..|.:..:|..|:      |.|.:.|.:    :|.|.|  
  Fly    72 AAVGALLAALFVQRVTKNVAYTSSGFLMIIAGILNVVL------PQHFLAACYSSVSVGAAYG-- 128

  Fly   123 CFTVIPIYI--AELASDNIRGILGVFLVLTCN-----FGLVLAF-------------VLGYYFNY 167
             .|.|...:  :|:|..:|||:|     |:|.     .|:.:..             ..||..:.
  Fly   129 -LTQIQALVTGSEVAHKSIRGML-----LSCEKIFLWLGVCMQVFYTRVWHNLRPLDTQGYEMHI 187

  Fly   168 AQVSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEEAEHSLRYYRNIK-SNPAKELSEELQLELQ 231
            .|:..:|  |:.:.:|..        .||..:::|.....|...|::. ....|.|..:...||.
  Fly   188 DQLHGMV--LAGLGLGAV--------ILALAHRLESPLLLLHQERDMAVGETLKALHGQSTTELV 242

  Fly   232 KLKTTEKTTADGVDDDDAATGVTWSDFAEGKTRKAF---LIGLGLISFNQ--LCGCFAMLNYTAV 291
            :|:...:......|         |..|.|.......   :....::.|.:  |..|||.|   ||
  Fly   243 RLREDCRQLHSARD---------WERFVEEPEESVADWRVWARRILPFFKVLLLRCFATL---AV 295

  Fly   292 IFEQAGSSLPPTVAAIIV---------------GVIQLMGTYASTVLVERLGRK-----ILLLVS 336
                   ||....|.::|               ....|:|:.....:|:..||:     .|.|..
  Fly   296 -------SLSYNRAFVVVSWHGLECDMNCMYWLAFAGLIGSVLGAFVVDWQGRRKVCSLSLFLAG 353

  Fly   337 AVGIGLGQSAMGTYSYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSE---IMPQKI 398
            .|.:.:|    |.:.:.:.:.......:.:.||....:..:...|.:::|.||.:.   .:..|.
  Fly   354 VVIVMVG----GVFDHLESVKRSFYDINLLVIALLMLLFEVIVAGGVAVPALVYTAEAFSIAHKA 414

  Fly   399 RSTAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAIFVPETK 456
            |..|.::::..|..:..    |:..|...:.:....|.....||:..:.:.:|:|||:
  Fly   415 RCLAGILIVEQLLQLGL----LLATFEHYITVSVFFFTIGVFSFIVGLTVFMFMPETR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 83/458 (18%)
CG14160NP_648380.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.