DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and CG8249

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster


Alignment Length:471 Identity:121/471 - (25%)
Similarity:223/471 - (47%) Gaps:46/471 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QYLAAISVNIISISYGAFCGWPSSSFLELSSENSPLDTGPLTPTDQGWVASNICLGGLVGTFLFT 74
            |.:|.|..|:...|.|.....|:::..:|.....|:.   |..:...|.||...|...:|..|..
  Fly    45 QVIAVILANVGVFSTGMTLAMPTATLHQLKDTTEPVH---LNDSQASWFASVNALSAPIGGLLSG 106

  Fly    75 WLADRIGRKLCLMWMALPNLLGWVIIPFARTP---------MHLIIARFIGGAAGGGCFTVIP-I 129
            :|.||||||..|:.:.:..:|.|:::   .||         ..||::||:.| .|.|..:..| :
  Fly   107 FLLDRIGRKKSLIVLNVLIILAWILL---ATPSESDQNAFFWQLIVSRFMLG-VGMGLASAPPGV 167

  Fly   130 YIAELASDNIRGILGVFLVLTCNFGLVLAFVLGYYF--NYAQVSWIVSSLSFVFVGCFWFMPETP 192
            |.||::....||.|.:...::...|:.:.:.:||..  ::..::.|......|.:.|...:||:.
  Fly   168 YAAEISVPKTRGSLILGTSISVAGGITILYGIGYCIRDDFRLIALICCGYQLVALLCVLPLPESH 232

  Fly   193 QHLAKINKIEEAEHSLRYYRNIKSNPAKELS-----EELQL---ELQKLKTTEKTTADGVDDDDA 249
            ..|....::.||:.||.|:|..  |.:.|::     ||.||   .||:..|..|.:         
  Fly   233 CWLLSKKRVTEAKRSLNYFRGF--NKSDEITHPQVLEEFQLLQKSLQQRNTAVKES--------- 286

  Fly   250 ATGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIVGVIQL 314
                .|.:..|.:..|..:|.:.|.:|.||.|.|.::.:...|.::||..:.|.:.|:::|:.:|
  Fly   287 ----FWRNLHEPEVYKPLVILMSLFAFQQLTGIFVVIVFAVQISQEAGIEIDPFMCAVLIGLARL 347

  Fly   315 MGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTYSYFQMLGCPVASFSWVPIAGFSFMLFLAA 379
            :.|.....::|..||:...::|.:|:.:....:..:|..::|    ....::|:......:.|:.
  Fly   348 ITTCPMGYILEWWGRRRAGIISTLGMSVCMFLLAGHSQIEIL----KEVPYLPVVAIVGFIVLST 408

  Fly   380 VGLLSLPFLVVSEIMPQKIRSTAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLA 444
            :||.:|||.::||:.|||:|..|..:.::....||...:|..|...|.|||.....:|..::..|
  Fly   409 LGLYTLPFFMISELFPQKVRGPASGLTVAVGMFISFVVLKTYPGIKEYLGMSNCFIIFGVMALFA 473

  Fly   445 AIFIAIFVPETKGKSV 460
            .||:.:.:|||:.:::
  Fly   474 LIFVYLALPETRRRTL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 109/421 (26%)
CG8249NP_001246349.1 MFS 49..479 CDD:119392 116/455 (25%)
Sugar_tr 60..496 CDD:278511 116/456 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444488
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
65.850

Return to query results.
Submit another query.