DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and sut4

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_523675.1 Gene:sut4 / 36055 FlyBaseID:FBgn0028560 Length:444 Species:Drosophila melanogaster


Alignment Length:461 Identity:143/461 - (31%)
Similarity:227/461 - (49%) Gaps:55/461 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GAFC-----GWPSSSFLELSSENSPLDTGPLTP--TDQGWVASNICLGGLVGTFLFTWLADRIGR 82
            ||||     ||......|:.:.|:    ...||  |:.|.|.|.:.||..........|..:|||
  Fly    16 GAFCLGAVIGWSGPVENEVKNSNA----YNFTPRQTEWGLVGSLMTLGAAFSCIPVGVLIGKIGR 76

  Fly    83 KLCLMWMALPNLLGWVIIPFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDNIRGILGVFL 147
            |..::.:..|..:||::|..|.....|::.||:.|..||......|:|:.|:|....||.:|.|.
  Fly    77 KTTMLILLPPFFIGWLLILLASHIAMLLLGRFVVGFCGGAFCVTCPMYVTEIAQVQYRGTMGCFF 141

  Fly   148 VLTCNFGLVLAFVLG-----YYFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEEAEHS 207
            .|...||::.|||:|     :|||.|     .:.|..:|.....||||:|..||:..|.|:||.|
  Fly   142 QLLIVFGILYAFVVGGFVKTFYFNIA-----CAILPVIFFVLMIFMPESPIFLAQKGKAEKAEKS 201

  Fly   208 LRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATGVTWSDFAEGK------TRKA 266
            |::.|...::.:.|| :|:..|.||    ||.:.                   ||      |.|.
  Fly   202 LKFLRGKDADVSGEL-KEMSAEGQK----EKASV-------------------GKILCRRITLKG 242

  Fly   267 FLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIVGVIQLMGTYASTVLVERLGRKI 331
            ..:.:||:.|.|:.|..|::.|:..|||.|||:|.|.::.||||::|.:.|..|.:::|::||||
  Fly   243 LFLSIGLMLFQQMTGINAIIFYSTFIFETAGSTLEPRISTIIVGIVQAIATIISILVIEKVGRKI 307

  Fly   332 LLLVSAVGIGLGQSAMGTYSYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQ 396
            ||||||..:|:....|..  ||.||  ..:...|:.:......:...::|...:|:|:::|:..:
  Fly   308 LLLVSACMMGISTLIMAL--YFGML--MKSGVGWLALIAVCVFIIGFSLGFGPVPWLMMAELFAE 368

  Fly   397 KIRSTAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAIFVPETKGKSVD 461
            .:::.|..|..:|.|..:.....|.||..:.:|......:|...:..|.:||...:||||||:::
  Fly   369 DVKALAGSIAGTTNWCFAFIVTLLFPVLNDIIGATACFAIFFGFAVAAFVFILFLIPETKGKTLN 433

  Fly   462 AILASL 467
            .|.|.:
  Fly   434 EIQAKM 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 127/414 (31%)
sut4NP_523675.1 Sugar_tr 9..436 CDD:278511 141/456 (31%)
MFS 47..424 CDD:119392 125/409 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444298
Domainoid 1 1.000 165 1.000 Domainoid score I819
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
76.850

Return to query results.
Submit another query.