DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and K09C4.2

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:91 Identity:20/91 - (21%)
Similarity:42/91 - (46%) Gaps:5/91 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 AVGLLSLPFLVVSEIMPQKIRSTAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFM--FASLS 441
            |.|..::..|.|:|:.|...|:.....::.....:....|.|.|:..   .:...:|.  |..:.
 Worm    11 ATGANAIRLLFVTELFPPSARTVVGQAMLFGSMAVGMPVVSLFPIIN---SIFSPIFFVPFVIVQ 72

  Fly   442 FLAAIFIAIFVPETKGKSVDAILASL 467
            .:..|::..::|||:|::|..|:.|:
 Worm    73 TVFGIYLYRYMPETRGRAVYDIIESM 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 13/74 (18%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.