DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG18754

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:272 Identity:82/272 - (30%)
Similarity:120/272 - (44%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAA 83
            |.||........||..:|:.......|.::   |..|||..|       :....|...|.|||||
  Fly    85 PELGDVLPNKQTCGQTTPVFRDRGAENAEL---NEYPWMVLL-------LYENRLSLIRYVLTAA 139

  Fly    84 HCFI-----PNTTIV--VRLGEYNRK--LKGYREEH---QVNRTFQHRFYDPN--THANDIALLR 134
            ||.|     .|..::  |||||....  ....|..|   :|.:|..|:.:..:  |:.|||||||
  Fly   140 HCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLR 204

  Fly   135 LVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC--- 196
            |...|.|...|:|||:: ||.:.....::::   :||..|:|   |..|.|..:..:....|   
  Fly   205 LQFPVRYTKKIQPICLL-DAEFPLQDLNLQI---SGWDPTKS---SQTLITSTVKERNPADCLNR 262

  Fly   197 --AFGSVLSNQFCAGNW-NSNLCIGDTGGPV-GAMVRYRNAFRFVQVGIAITNKR-CQR---PSV 253
              :|.|  ::|.|||.. ..:.|.|.:|.|| |.|....:.|.|: .|||...:: |..   |.|
  Fly   263 YPSFRS--ASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFL-AGIASYGQQYCYSAGIPGV 324

  Fly   254 FTDVMSHIEFIR 265
            :|.:....|:|:
  Fly   325 YTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 75/246 (30%)
Tryp_SPc 43..267 CDD:238113 76/248 (31%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 76/249 (31%)
Tryp_SPc 108..335 CDD:214473 75/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.