DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and KLK6

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:234 Identity:72/234 - (30%)
Similarity:116/234 - (49%) Gaps:24/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYN-RKLKG 105
            ::|:|....:.|.|:.|.|:||.: .:|||.||....|||||||..||  :.|.||::| |:.:.
Human    21 KLVHGGPCDKTSHPYQAALYTSGH-LLCGGVLIHPLWVLTAAHCKKPN--LQVFLGKHNLRQRES 82

  Fly   106 YREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTG 170
            .:|:..|.|...|..||..:|..||.||||.........|:|:.:..|.|  .:..|..:|   |
Human    83 SQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCS--ANTTSCHIL---G 142

  Fly   171 WGRTE--SMHDSSELRTLD-ISRQPSKMCAFGSVLSNQFCAGN--WNSNLCIGDTGGPVGAMVRY 230
            ||:|.  ...|:.:...:. :||:..:....|.:..|..|||:  :..:.|.||:|||:......
Human   143 WGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHL 207

  Fly   231 RNAFRFVQVGIAITNKRC---QRPSVFTDVMSHIEFIRR 266
            |..       ::..|..|   ::|.|:|:|..:..:|::
Human   208 RGL-------VSWGNIPCGSKEKPGVYTNVCRYTNWIQK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 71/230 (31%)
Tryp_SPc 43..267 CDD:238113 72/233 (31%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.