DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:66/252 - (26%)
Similarity:104/252 - (41%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LKLGPRIVNGKVAVRNSSPWMAFLHTSSN-QFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYN 100
            :|:..||.||..|.....|::..|..|.| .:.|||::|....|||||||....:.:.:..|...
  Fly    32 VKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASL 96

  Fly   101 RKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKV 165
            |....|..........||..|:.....|||:|:|           .|....|     |.::.:::
  Fly    97 RNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-----------TPHVDFW-----HLVNKVEL 145

  Fly   166 --------------LTGTGWGRTESMHDSSE----LRTLDISRQPSKMCA-FGSVLSNQFCAG-N 210
                          ...:|||.|   :|.|.    |:.:|:.......|: ..|:..|..|.. |
  Fly   146 PSYNDRYQDYAGWWAVASGWGGT---YDGSPLPDWLQAVDVQIMSQSDCSRTWSLHDNMICINTN 207

  Fly   211 WNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQ--RPSVFTDVMSHIEFIR 265
            ...:.|.||:|||   :|.:... |.|.|...:::..||  .|:||:.|..::::||
  Fly   208 GGKSTCGGDSGGP---LVTHEGN-RLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/244 (26%)
Tryp_SPc 43..267 CDD:238113 64/246 (26%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 63/244 (26%)
Tryp_SPc 38..262 CDD:238113 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.