DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG9737

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:318 Identity:86/318 - (27%)
Similarity:137/318 - (43%) Gaps:81/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVL 80
            ||.|..|..  |.:|||.    ::..||..|::|..:..||:|.|..:||.:.|.|.||..|.:|
  Fly   129 TVEPSSGFN--LLNECGK----QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHIL 187

  Fly    81 TAAHCFIPNTTI-------VVRLGEYNRKLK-------------------GYREEHQVNRTFQHR 119
            ||||| :....:       .|||||:|.|.:                   .|.:.|      .|.
  Fly   188 TAAHC-VQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIH------VHP 245

  Fly   120 FYD--PNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG-----TGWGRTE-- 175
            .|.  .|...||||::||...|.:...:.|||:      .:..:.:.:..|     :|||||:  
  Fly   246 EYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICL------PNKSEPLTLAEGQMFSVSGWGRTDLF 304

  Fly   176 -----SMHDSSELRTLDISRQPSKMC-----AFGSVLS-NQFCA-GNWNSNLCIGDTGGPVGAMV 228
                 ::|...:|: |.|....::.|     .||..|. .|.|| |.:..:.|.||:|||:....
  Fly   305 NKYFINIHSPIKLK-LRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFD 368

  Fly   229 RYRN--------AFRFVQVGIAITNKRCQRPSVFTDVMSHIEFIRRIFLTQNGNDRNQ 278
            |..:        ::.|.|.|:|      .:|:|:|:|..:.::|..:...:..:.:.|
  Fly   369 RQHSRWVAYGVVSYGFTQCGMA------GKPAVYTNVAEYTDWIDSVVQQRKKSQQTQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 76/276 (28%)
Tryp_SPc 43..267 CDD:238113 76/278 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 76/276 (28%)
Tryp_SPc 150..409 CDD:238113 76/278 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.