DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG11842

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:121/284 - (42%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFL-HTSSN---QFICGGTLISRRLV 79
            |::..|  || :|.:.:||     |:.|..||....|..|.| |...|   ::.|||||||.|.|
  Fly    57 PIIYKT--LD-KCTSYAPL-----IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHV 113

  Fly    80 LTAAHC-FIPNTTI-VVRLGEY---NRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNV 139
            |||||| :.|..:: :.|||:.   ........|:..|.....|..:......|||:::||...|
  Fly   114 LTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPV 178

  Fly   140 VYKANIRPICIMWDASWKHHIDSIKVLTGT-----GWGRTESMHDSSELRTLDISRQPSKMCAFG 199
            .:.....|.|:.:|..          ..||     |||:.|.:.     ||.:...|..|:..:|
  Fly   179 TFNDYKHPACLPFDDG----------RLGTSFIAIGWGQLEIVP-----RTENKKLQKVKLYNYG 228

  Fly   200 S----------------VLSNQFCAG-NWNSNLCIGDTGGPVGAMVRYRNAF--RFVQVGIAITN 245
            :                ..:.|.|.| |.:.:.|.||:||||   :.|...:  .:..:||....
  Fly   229 TRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPV---LIYHMDYPCMYHVMGITSIG 290

  Fly   246 KRCQR---PSVFTDVMSHIEFIRR 266
            ..|..   |:::|.|..::::|::
  Fly   291 VACDTPDLPAMYTRVHFYLDWIKQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 69/257 (27%)
Tryp_SPc 43..267 CDD:238113 70/260 (27%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 70/260 (27%)
Tryp_SPc 73..312 CDD:214473 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.