DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and grass

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:269 Identity:83/269 - (30%)
Similarity:128/269 - (47%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECGTRSPLKLGPRIVNGKVAVRNSSPWMAFL---HTSSNQFICGGTLISRRLVLTAAHCF--IPN 89
            :||.    .|..|:.||.....:|.||||.|   ....::|:|||.:||.|.:||||||.  :.|
  Fly   110 DCGN----FLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQN 170

  Fly    90 TTIVVRLGEY-----------NRKLK--------GYREEHQVNRTFQHRFYDPNTHANDIALLRL 135
            ....:||||:           .||.|        |. |:|.:     |..||.....:|||||:|
  Fly   171 DLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGI-EKHLI-----HEKYDARHIMHDIALLKL 229

  Fly   136 VSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFG- 199
            ..:|.::.:|:|||:......|...:.|.....||||.||:...|..|...::..||...|:.. 
  Fly   230 NRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAY 294

  Fly   200 --SVLSNQFCAGNWN-SNLCIGDTGGPVGAMVRYRNAF--RFVQVGI----AITNKRCQRPSVFT 255
              :|..:|.|.|..: .:.|.||:|||:.|..:|...:  :.|:.||    .:|..:...|.::|
  Fly   295 RRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYT 359

  Fly   256 DVMSHIEFI 264
            :|..::::|
  Fly   360 NVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 79/255 (31%)
Tryp_SPc 43..267 CDD:238113 79/256 (31%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 79/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.