DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG31219

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:262 Identity:79/262 - (30%)
Similarity:119/262 - (45%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RIVNGKVAVRNSSPWMA---FLHTSSNQFI--CGGTLISRRLVLTAAHCF--IPNTTIV--VRLG 97
            |:|.|..|..|..||||   :|:|::.:.:  |.|:||:.|.|||:|||.  ||....:  ||||
  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG 152

  Fly    98 E--------YNRKLKGYRE-------EHQVNRTFQHRFYDPNTHAN---DIALLRLVSNVVYKAN 144
            |        ||...:....       |.::.:...|..:...::.|   |||||||...|.|:..
  Fly   153 EHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTG 217

  Fly   145 IRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVL-----SN 204
            |.||||.     ||...:...|...|||:|.....|..|....|..:...:||.....     |.
  Fly   218 IMPICIP-----KHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL 277

  Fly   205 QFCAGNWNS-NLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQR---PSVFTDVMSHIEFIR 265
            |.|||.::. :.|.||:|||:  ||...|:..::.......:|.|.:   |.::|...:.:.:|:
  Fly   278 QICAGGYDGVDTCQGDSGGPL--MVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340

  Fly   266 RI 267
            .:
  Fly   341 AV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 78/257 (30%)
Tryp_SPc 43..267 CDD:238113 78/259 (30%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 78/257 (30%)
Tryp_SPc 90..342 CDD:238113 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.