DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG5246

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:294 Identity:74/294 - (25%)
Similarity:124/294 - (42%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLTVFPLLGSTQFLDSECGTRS--------------PLKLGPRIVNGKVAVRNSSPWMAFLHT 62
            |:|::|..:|       |:|..:|              .:|...|::.|..:....:|:...:..
  Fly     4 LVLISVLVIL-------SQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMN 61

  Fly    63 SSNQFICGGTLISRRLVLTAAHCF---IPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPN 124
            :..:.:|||::|:.:.:||||||.   |....||....:|.|.    ..|:.|:.:..|..:|..
  Fly    62 TFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRP----GAEYLVDGSKIHCSHDKP 122

  Fly   125 THANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESM-HDSSELRTLDI 188
            .:.|||||:.....:||....:||.:....|.....|.   ||.||||.|::. ..|::|:.:|:
  Fly   123 AYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK---LTLTGWGSTKTWGRYSTQLQKIDL 184

  Fly   189 SRQPSKMCAFGSVLSNQFCAGNWNS------------NLCIGDTGGPVGAMVRYRNAFRFVQVGI 241
            :......|.  |.:.|    .||.|            ..|.||:|||   :|......    ||:
  Fly   185 NYIDHDNCQ--SRVRN----ANWLSEGHVCTFTQEGEGSCHGDSGGP---LVDANQTL----VGV 236

  Fly   242 AITNKRCQ--RPSVFTDVMSHIEFIRRIFLTQNG 273
            ....:.|.  .|.||..|..:.::|.:: :|..|
  Fly   237 VNWGEACAIGYPDVFGSVAYYHDWIEQM-MTDAG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/239 (26%)
Tryp_SPc 43..267 CDD:238113 63/241 (26%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/239 (26%)
Tryp_SPc 42..263 CDD:238113 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.