DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and modSP

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:302 Identity:71/302 - (23%)
Similarity:115/302 - (38%) Gaps:73/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QFLDSECG-TRSPLKLGPRIVNGKVAVRNS-SPWMAFLHTSSNQ----FICGGTLISRRLVLTAA 83
            |..:.:|| ..:|:|   :..:|...:.|: .||...|:...|:    |.|||:|::..||:|||
  Fly   352 QRCEQDCGQLATPIK---QFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAA 413

  Fly    84 HCFIPNTTIV-----------------------------VRLGEYNRKLKGYREEHQVNRTFQHR 119
            ||.....|.:                             |||.|.....||..|.:.        
  Fly   414 HCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYY-------- 470

  Fly   120 FYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG--TGWGRTESMHDSSE 182
                    .|:|||.|.........|||||:.: ||:.........:.|  .|| ..|:.|   |
  Fly   471 --------QDLALLTLDEPFELSHVIRPICVTF-ASFAEKESVTDDVQGKFAGW-NIENKH---E 522

  Fly   183 LRTLDISRQPSKMCA--FGSVLSNQFCAGNWNSNL-CIGDTGG------PVGAMVRYRNAFRFVQ 238
            |:.:....:.:.:|.  ...:.:::||......:| |.||:||      |..|...:..|..|: 
  Fly   523 LQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFL- 586

  Fly   239 VGIAITNKRCQRPSVFTDVMSHIEFIRRIFLTQNGNDRNQPT 280
            .|:........:.:....||::|:....:.|  |..:|:..|
  Fly   587 FGVISNAPNADQCAHSLTVMTNIQHFEDMIL--NAMNRSVET 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 62/266 (23%)
Tryp_SPc 43..267 CDD:238113 62/268 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 1/1 (100%)
Tryp_SPc 371..616 CDD:214473 62/266 (23%)
Tryp_SPc 371..591 CDD:304450 59/241 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.