DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG3505

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:315 Identity:85/315 - (26%)
Similarity:120/315 - (38%) Gaps:106/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DSECGTR---------SPLKLG----PRIVN--GKVAVRNSS---------PWMAFL-HTSSNQ- 66
            |::||.|         |...||    |.:.:  |||..:.|:         ||:|.: :|..|| 
  Fly    68 DNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQE 132

  Fly    67 --FICGGTLISRRLVLTAAHCFIPNTT-----IVVRLGEYNRKLK---GYREEHQV--------- 112
              ..|||.|||.|.|||||||.....|     ..|||||::....   .|.|:.:|         
  Fly   133 KIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQD 197

  Fly   113 ---NRTFQHRFYD--PNTHANDIALLRLVSNVVYKANIRPICIM------------------WDA 154
               .....|..|:  ..|..|||||:||.|.......::|||:.                  |.|
  Fly   198 IAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQA 262

  Fly   155 SWKHH-------IDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVLSNQFCAGNWN 212
            |....       |.||:        ..:..:.|.:||.     |.||:|            |..|
  Fly   263 SSSQRMRKGYVTISSIE--------ECQRKYASQQLRI-----QASKLC------------GLTN 302

  Fly   213 SNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQR---PSVFTDVMSHIEFI 264
            |..|.|:.|||   ::.::|....:...::.....|..   |.|:|.|.|:|::|
  Fly   303 SQECYGNAGGP---LMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 76/286 (27%)
Tryp_SPc 43..267 CDD:238113 77/287 (27%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 4/13 (31%)
Tryp_SPc 111..356 CDD:238113 73/272 (27%)
Tryp_SPc 111..354 CDD:214473 72/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.