DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG31326

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:264 Identity:89/264 - (33%)
Similarity:125/264 - (47%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGTRSPLKLGPRIVNGKVAVRNSSPWMA--FLHTSSN--QFICGGTLISRRLVLTAAHCF----- 86
            || |......|.|..||...|...||:.  |....||  .|||||||||...||:|||||     
  Fly   263 CG-RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGR 326

  Fly    87 -IPNTTIVVRLGEYNRKLKG---YREEHQ--VNRTFQHRFYDPNTHANDIALLRLVSNVVYKANI 145
             :|.:.:.|.||.....:..   :|...|  ::..||.:.:   |.| |:||:||...|.|...|
  Fly   327 DLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQF---TEA-DLALVRLDEPVRYTDYI 387

  Fly   146 RPICIMWDASWKHHIDSIKVLTG--TGWGRTESMHDSSEL-RTLDISRQPSKMCAFG----SVLS 203
            .||| :|..|  :.:|..:.|..  .|||..|:...::|: :..|::......||..    .|..
  Fly   388 VPIC-LWSTS--NRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQP 449

  Fly   204 NQFCAGNWNSNLCIGDTGGPVGAMVRYRNAF--RFVQVGIAITNKR--CQ--RPSVFTDVMSHIE 262
            :..||....:..|..|.|||:  |:|.::.:  |.|..|..|..|.  |:  :|||||||..|||
  Fly   450 SSLCAKKTGAGPCASDGGGPL--MLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIE 512

  Fly   263 FIRR 266
            ::|:
  Fly   513 WVRQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 84/249 (34%)
Tryp_SPc 43..267 CDD:238113 85/252 (34%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 84/249 (34%)
Tryp_SPc 277..514 CDD:214473 83/245 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.