DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG9649

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:127/267 - (47%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDSECGTRSPLKLGPRIVNGKVAVRNSSPWMA--FLHTSSN-QFICGGTLISRRLVLTAAHCF-- 86
            |...||....::. |.|.||....|...||||  |.|...: .|:|||||||.|.|::|||||  
  Fly   242 LSGICGREKVIQT-PFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRF 305

  Fly    87 ----IPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHAN-DIALLRLVSNVVYKANIR 146
                :|....:|.||..:..|........|.|...|..|:||.:.: |:|||:|.::|.....|:
  Fly   306 GSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIK 370

  Fly   147 PICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTL-------------DISRQPSKMCAF 198
            ||| :|:.::...:.|.......|||..|..:.::.|..:             ::|.:.:|.   
  Fly   371 PIC-LWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKF--- 431

  Fly   199 GSVLSNQFCAGNWN-SNLCIGDTGGPVGAMVRYRNAFRF---VQVGIAITNKRCQ--RPSVFTDV 257
              :.|:..||.|.. |..|.||:||  |.|::.::.:..   |..|..:|| ||.  .|.::|||
  Fly   432 --ITSHTICASNAQASGPCSGDSGG--GLMLQEQDIWMLRGVVSAGQRMTN-RCNLTLPVIYTDV 491

  Fly   258 MSHIEFI 264
            ..|||::
  Fly   492 AKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 80/250 (32%)
Tryp_SPc 43..267 CDD:238113 80/251 (32%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 80/249 (32%)
Tryp_SPc 259..497 CDD:214473 78/246 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.