DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG13318

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:123/283 - (43%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTA 82
            :.|:...|....:||.|.|...|........|...:.||.|.|.|:::.::.||.||:.:.||||
  Fly   138 YGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVLTA 202

  Fly    83 AHCF--IPNTTIVVRLGEYNRKLKGY---REEHQVNRTFQHRFYDPNTHANDIALLRLVS--NVV 140
            ||..  :..|...|||||::......   .::..::..:.:..::||...||:|:|:|.:  ::.
  Fly   203 AHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLT 267

  Fly   141 YKANIRPICI---------MWDASWKHHIDSIKVLTGTGWGRTE----SMHDSSELRTLDISRQP 192
            .|:.:..:|:         .|.|               |||:.:    ..:.:.| |.:|:...|
  Fly   268 SKSTVGTVCLPTTSFVGQRCWVA---------------GWGKNDFGATGAYQAIE-RQVDVPLIP 316

  Fly   193 SKMC-------AFGS--VLS--NQFCA-GNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITN 245
            :..|       ..||  |||  :..|| |....:.|.||.|.|   :|...|...:| ||:....
  Fly   317 NANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSP---LVCTSNGVWYV-VGLVAWG 377

  Fly   246 KRCQR---PSVFTDVMSHIEFIR 265
            ..|.:   |.|:.:|.:::.:|:
  Fly   378 IGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/256 (25%)
Tryp_SPc 43..267 CDD:238113 64/258 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 64/252 (25%)
Tryp_SPc 169..399 CDD:214473 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.