DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and MP1

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:270 Identity:80/270 - (29%)
Similarity:122/270 - (45%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFI----CGGTLISRRLVLTAAHCF--IPN 89
            ||.    ..|.|:|.|....:...||||.:..:....:    |||:||:.|.|||||||.  ||:
  Fly   130 CGE----NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPS 190

  Fly    90 TTIV--VRLGEYNRKL--------KGYRE------EHQVNRTFQHRFYDPNT--HANDIALLRLV 136
            ...:  |||||::...        .|.|:      ::.|.....|..|..|:  ..||||||||.
  Fly   191 DWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLR 255

  Fly   137 SNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC----- 196
            ..|.|...|.|:|:...||..::|...:.:...||||||:...|:.....::...|:..|     
  Fly   256 DEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYA 320

  Fly   197 -AFGSVLSNQFCAGNWNS-NLCIGDTGGPVGAMVRYR--NAFRFVQVGIAITNKRCQR---PSVF 254
             ...:|.:.|.|||.... :.|.||:|||: .:..|.  |:..::...::.....|..   |.|:
  Fly   321 TQRRTVTTKQMCAGGVEGVDSCRGDSGGPL-LLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVY 384

  Fly   255 TDVMSHIEFI 264
            |.|.:::.:|
  Fly   385 TRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 76/257 (30%)
Tryp_SPc 43..267 CDD:238113 76/258 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 76/257 (30%)
Tryp_SPc 138..397 CDD:238113 76/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463625
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.