DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and Jon74E

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:126/282 - (44%) Gaps:41/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFI---C 69
            :::||:.|.:.....|...||...|      :|.||..|::|..|..|:...|.......:   |
  Fly     3 ISTILVFLLILVQGRSISCLDMGHG------IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWC 61

  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTH-------- 126
            |.:|||.|.:||||||......|...||...|     ....|:.|:     .:|..|        
  Fly    62 GASLISDRYLLTAAHCVEKAVAITYYLGGVLR-----LAPRQLIRS-----TNPEVHLHPDWNCQ 116

  Fly   127 --ANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGR--TESMHDSSELRTLD 187
              .|||||:||..:.:...:||||.:...:|.::..|.:..: .:||||  .||...|..||.:.
  Fly   117 SLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI-ASGWGRMNDESTAISDNLRYVY 180

  Fly   188 ISRQPSKMC--AFGSVLSNQFCAG-NWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR-- 247
            ...:.::.|  ::.::.....|.. ....:.|.||:|||:......:||  .:.:|:....|:  
  Fly   181 RFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNA--DILIGVTSYGKKSG 243

  Fly   248 CQR--PSVFTDVMSHIEFIRRI 267
            |.:  |||||.:.:::::|..:
  Fly   244 CTKGYPSVFTRITAYLDWIGEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 67/243 (28%)
Tryp_SPc 43..267 CDD:238113 67/245 (27%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.