DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG33460

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:126/270 - (46%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTVFPLLGSTQFLDSECG---TRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLIS 75
            :|.::....|..:|..:||   ......||              ||.|.|||..:.| |.||||:
  Fly    14 MLVIYSDSVSANYLYEQCGLMREEFSTSLG--------------PWTALLHTDGSIF-CAGTLIT 63

  Fly    76 RRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVV 140
            ...:||||.|..|| .:.|||||:.|......|:|.|:....:|.::..:.||:|.||:|...|.
  Fly    64 DVFILTAASCIRPN-AVKVRLGEFGRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQ 127

  Fly   141 YKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVLSNQ 205
            ....|.|:||:.:.. ...:.:::.: |..|....::..:.|||.:.|..:| |||. ...|..|
  Fly   128 ITDYIMPVCIVLNPQ-NQQLSTMRFI-GNAWMEDSNVSLTKELRPIVIQSKP-KMCT-NLDLYTQ 188

  Fly   206 FCAGN-WNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR-CQRPSVFTDVMSHIEFIRRIF 268
            ||||: .|...|.|.||..:....||.|.:|.:|.|||..|.. |:....:|||:....:|:.:.
  Fly   189 FCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVV 253

  Fly   269 LTQNGNDRNQ 278
            ...|....|:
  Fly   254 SLFNHYSTNE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 74/223 (33%)
Tryp_SPc 43..267 CDD:238113 75/225 (33%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 75/213 (35%)
Tryp_SPc 44..249 CDD:214473 74/210 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.