DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG6592

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:321 Identity:85/321 - (26%)
Similarity:131/321 - (40%) Gaps:62/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SECGTRSPLKLG------------------PRIVNGKVAVRNSSPWMA--FLHTSSNQFICGGTL 73
            ||...|.||.|.                  .||..|.|...:..|:..  .|......:.|||:|
  Fly    91 SEEDDREPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSL 155

  Fly    74 ISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQV-----NRTFQ-HRFYDPNTHANDIAL 132
            ||.:.|:|||||.......:|.||.  .::|..:|:.||     :..|| :..::|....:|||:
  Fly   156 ISDKHVITAAHCVDMAKRALVFLGA--NEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAI 218

  Fly   133 LRLVSNVVYKANIRPICIMWDASWKHHID----SIKVLTGTGWGR-TESMHD-SSELRTLDISRQ 191
            :||...|.:...|.||.:.     |.|.:    ..|:...:|||| ...:|. |:.||.:.:...
  Fly   219 VRLPHAVSFNERIHPIQLP-----KRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQII 278

  Fly   192 PSKMCAFGSVLS---NQFCAGNWNS-NLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNK--RCQR 250
            ..:.|.....||   ...|....|: :.|.||:|||:  :::.|::.:.|.|||.....  .|.|
  Fly   279 DGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDR 341

  Fly   251 --PSVFTDVMSHIEFI-------------RRIFLTQNGNDRNQPTPKPDKEPEFDWNNPYP 296
              |:.||.|.|::::|             ..||..|...:..:|......|.|....:..|
  Fly   342 GYPAAFTKVASYLDWISDETGVSAHQDTTEAIFFDQYVREYGKPRQSRRLETEEQLEDDVP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 71/243 (29%)
Tryp_SPc 43..267 CDD:238113 71/258 (28%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/243 (29%)
Tryp_SPc 123..359 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.