DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and yip7

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:108/237 - (45%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RIVNGKVAVRNSSPWMAFLHTSSN--QFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLK 104
            ||.|||.||....|:...|..||:  .:.|||::|....|||||||.....::.:..|...|...
  Fly    39 RITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSP 103

  Fly   105 GYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGT 169
            .:.:....::..||..|...|..|||:|:: .|:|.:.|.:..|.:. ..|..:.....|....:
  Fly   104 EFTQVVSSSKFRQHESYLALTIRNDISLIQ-TSSVSFSATVNKISLP-AVSNSYSTYEGKTAVAS 166

  Fly   170 GWGRT--ESMHDSSELRTLDISRQPSKMC--AFGS--VLSNQFCAGNWN-SNLCIGDTGGPVGAM 227
            |||.|  ::...|.:|:.:|::...:..|  .|||  |.|...|....| ::.|.||:|||:   
  Fly   167 GWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPL--- 228

  Fly   228 VRYRNAFRFVQVGIAITNKR--CQ--RPSVFTDVMSHIEFIR 265
                 |...|.:|.......  |:  .|:.||.:..:.::|:
  Fly   229 -----ALDGVLIGATSFGSADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 66/234 (28%)
Tryp_SPc 43..267 CDD:238113 66/236 (28%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 66/234 (28%)
Tryp_SPc 40..267 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.