DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG15873

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:255 Identity:70/255 - (27%)
Similarity:103/255 - (40%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTVF-PLLGSTQFLDSECGTRSPLK--------------LGPRIVNGKVAVRNSSPWMAFLHTS 63
            :|||| .|:.||...|::.|....:.              ...|:....|::|..:   ...|..
  Fly     3 ILTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKN---YVRHRG 64

  Fly    64 SNQFICGGTLISRRLVLTAAHCFI--------PNTTIVV-----RLGEYNRKLKGYREEHQVNRT 115
            .|.| |.|.|:|.|.|||||||..        |....||     ||..|:..     :...|:|.
  Fly    65 DNHF-CSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDES-----DFRSVDRL 123

  Fly   116 FQHRFYDPNTHANDIALLRLVSNVVYKAN--IRPICIMWDASWKHHIDSIKVLTGTGWGRTESMH 178
            ..|..|: ....||:|:||| |..|..:|  :.|:.:...|:..:....|.:    |||:. ..|
  Fly   124 VVHPEYE-RYKKNDLAILRL-SERVQSSNHDVLPLLMRKTANVTYGDTCITL----GWGQI-YQH 181

  Fly   179 D--SSELRTLDISRQPSKMC-----AFGSVLSNQFCAGNWNSNL-CIGDTGGPV---GAM 227
            .  |:||..||:..:|..:|     .|  ...:..|......:: |.||.|||:   ||:
  Fly   182 GPYSNELVYLDVILRPPSLCQKHYDTF--TADHNVCTEPVGESMNCAGDMGGPLLCKGAL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 61/212 (29%)
Tryp_SPc 43..267 CDD:238113 60/211 (28%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 61/222 (27%)
Tryp_SPc 59..250 CDD:238113 58/196 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.