DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG13527

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:332 Identity:76/332 - (22%)
Similarity:110/332 - (33%) Gaps:122/332 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILLLLTVFPL---------LGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQ 66
            :.:|:||..:         |.|.:|...|     .|:|...:    |::|:.:|...|   ..|.
  Fly     8 VAILITVMVILSGAHRMKRLSSPKFHGDE-----TLELAKYV----VSIRSRTPNKYF---GDNH 60

  Fly    67 FICGGTLISRRLVLTAAHCFIPNTTIVVRL----------------------------------- 96
            : |||.|:|.:.|:|||||.:..:.|:.:.                                   
  Fly    61 Y-CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFT 124

  Fly    97 --GEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHH 159
              ..:|..|...:|:...|        ||.     |..|.|..... |..||            |
  Fly   125 MHNTFNMALMKLQEKMPSN--------DPR-----IGFLHLPKEAP-KIGIR------------H 163

  Fly   160 IDSIKVLTGTGWGRTESMHDSSELRT----LDISRQPSKMCA--FGSVLSNQFCAGNWNSNL--- 215
                   |..||||   |:....|..    :|:....:.:|.  |........||||.|..:   
  Fly   164 -------TVLGWGR---MYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAE 218

  Fly   216 -CIGDTGGP------VGAMVRYRNAFRFVQVGIAITNKRCQRPSVFTDVMSHIEFIRRIFLTQNG 273
             |.||.|.|      |..:|.|       .:|...||    .|||:|||.|.:.:||........
  Fly   219 PCSGDIGSPLLSGKVVVGIVAY-------PIGCGCTN----IPSVYTDVFSGLRWIRHTAYDWAS 272

  Fly   274 NDRNQPT 280
            ..:..||
  Fly   273 ITKTNPT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/274 (23%)
Tryp_SPc 43..267 CDD:238113 65/276 (24%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 65/277 (23%)
Tryp_SPc 43..263 CDD:214473 63/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.