DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and try-9

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:297 Identity:63/297 - (21%)
Similarity:103/297 - (34%) Gaps:105/297 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RIVNGKVAVRNSSPWMAFLHTSSNQFI--CGGTLISRRLVLTAAH-------------------- 84
            ||.:|..:.||...     ..|.|:|:  ..|||:|...::||||                    
 Worm     4 RISDGSGSFRNGGN-----KFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREA 63

  Fly    85 ----------CFIPNTTIVVRL--GEYNRKL------------KGYREEHQVNR-TFQHRFYDPN 124
                      .|:..|..|..:  |.:.:.:            |||..:..::| :|        
 Worm    64 YFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESF-------- 120

  Fly   125 THANDIALLRLVSNVVYKANIRPICI--------MWDASWKHHIDSIKVLTGTGWGRTESMHDSS 181
               ||||:..|...:.:..:|.|.|:        :.:..:|        |.|.|...::|:.:|.
 Worm   121 ---NDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYK--------LFGYGRDPSDSVLESG 174

  Fly   182 ELRTL-DISRQPSKMCAFGSVLSNQFCAGNWNSNL-CIGDTGGPVGAMVRYRNAFRFVQVGIAIT 244
            :|::| ....:.|....:|.|    :|....|..| |.||:|..|......||.  .|.||:...
 Worm   175 KLKSLYSFVAECSDDFPYGGV----YCTSAVNRGLSCDGDSGSGVVRTSDTRNV--QVLVGVLSA 233

  Fly   245 NKRC------------------QRPSVFTDVMSHIEF 263
            ...|                  |...:..||.:|::|
 Worm   234 GMPCPELYDTHNRQRQQRRQLTQETDLLVDVSAHVDF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/297 (21%)
Tryp_SPc 43..267 CDD:238113 62/296 (21%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 49/231 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.