DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and scaf

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:294 Identity:84/294 - (28%)
Similarity:119/294 - (40%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TQFLDSECGT-----RSPLKLGPRIVN--GKVAVRNSS----------------PWMA-FLHTSS 64
            |..|.:|.|:     |.|..:.|..||  |..|.||..                ||.| .|..||
  Fly   381 TDCLQTENGSPGKCCRDPNYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESS 445

  Fly    65 NQFICGGTLISRRLVLTAAHCF--IPNTTIVVRLGEYNR---------KLKGYREEHQVNRTFQH 118
            ...||||.:|..:.||::|.|.  :|.|.|.|:.||:..         :|.|      |.....|
  Fly   446 KTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTG------VKTVDVH 504

  Fly   119 RFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTE-SMHDSSE 182
            ..|||:|:::|:|::||...:.:.::|:||||. |...|   ||.:..| :|||:.. |:|:...
  Fly   505 PDYDPSTNSHDLAIIRLERRLEFASHIQPICIS-DEDPK---DSEQCFT-SGWGKQALSIHEEGA 564

  Fly   183 LR----TL-----DISRQPSKMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQ 238
            |.    ||     :.|...|.:|:.....|.||..|   |.|..|.     |:.||.:       
  Fly   565 LMHVTDTLPQARSECSADSSSVCSATKFDSCQFDVG---SALACGS-----GSSVRLK------- 614

  Fly   239 VGIAITNKRCQRPSVFTDVMSHIEFIRRIFLTQN 272
             ||......|............|::|...|...|
  Fly   615 -GIFAGENSCGEGQTVRFAKPDIKWINTAFAENN 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 74/261 (28%)
Tryp_SPc 43..267 CDD:238113 75/263 (29%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 64/214 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.