DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and scaf

DIOPT Version :10

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:163 Identity:39/163 - (23%)
Similarity:52/163 - (31%) Gaps:54/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PKDPCASCPSNSVCRVV------------GGR---------PT-CSCP-EGYRGTPPACRPECSS 165
            |:|.|.....|...|.|            ..|         || |||. :|||.|.|......|.
  Fly    98 PQDSCTYLTDNFRSRCVQIYNYHRLLSWDAARGLHVDIFKVPTCCSCHIDGYRETFPPLTSYNSD 162

  Fly   166 SEECPHDRSCINLKCADPCPGLCGI-----NAQCQVINHKPFCSCQRDMI-------------GN 212
            .:...|:         ||......:     :...|..:|..:.:.|.|.:             .|
  Fly   163 FKSKIHE---------DPSESASTLIRNTHSNHHQQHHHSHYSTLQFDQVDEEEPEDNIAYQFSN 218

  Fly   213 PFEQCYPKPAEPVHPYLPARHPIDPCSPSPCGP 245
            .|::..||....:|  |||..|..|  |.|.||
  Fly   219 GFQRIKPKYEGALH--LPAVPPPQP--PPPQGP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 39/163 (24%)
scafNP_610180.1 Atrophin-1 <63..>338 CDD:460830 39/163 (24%)
CLIP_SPH_Scar 343..408 CDD:465747
Tryp_SPc 428..616 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.