DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:254 Identity:66/254 - (25%)
Similarity:106/254 - (41%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRK 102
            |:..||.||..|....:|:...|..|...: |||::|:...||||.||.....:::|..|...| 
  Fly    32 KIEGRITNGYAAPEGKAPYTVGLGFSGGWW-CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWR- 94

  Fly   103 LKGYREEHQVNRTFQHRFYDPN--THAN-DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIK 164
                     .|..|.|...:.|  .|:| ||||:|:           |....|     |.::.::
  Fly    95 ---------TNAQFTHTVGNGNFIKHSNADIALIRI-----------PHVDFW-----HMVNKVE 134

  Fly   165 V--------------LTGTGWGRTESMHDSSE----LRTLDISRQPSKMC--AFGSVLSNQFCAG 209
            :              ....|||.|   :|.|.    |:.:|:....::.|  .:|||..|..|..
  Fly   135 LPSYNDRYNNYNEWWAVACGWGGT---YDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNVICTR 196

  Fly   210 NWN-SNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQ--RPSVFTDVMSHIEFIR 265
            ..: .::|.||:|||:..    .:..:.|.|...:::..||  .|:.|..|..|:::||
  Fly   197 TVDGKSICGGDSGGPLVT----HDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 63/247 (26%)
Tryp_SPc 43..267 CDD:238113 64/249 (26%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 63/247 (26%)
Tryp_SPc 37..253 CDD:238113 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.