DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG8952

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:276 Identity:76/276 - (27%)
Similarity:130/276 - (47%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSS-NQFICGGTLI 74
            :|:||....::|  |..|.  ...||:|:..|||:|..|.....||...|...: :..:|||::|
  Fly    10 MLVLLAAISVVG--QPFDP--ANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSII 70

  Fly    75 SRRLVLTAAHCFIPNTTIVVRLGE---YNRKLKGYREEHQVNRTFQHRFYDPNTH---ANDIALL 133
            |...|||||||....::|.:..|.   :|        .:.:|.|..:....|:.:   .||::|:
  Fly    71 SDTWVLTAAHCTNGLSSIFLMFGTVDLFN--------ANALNMTSNNIIIHPDYNDKLNNDVSLI 127

  Fly   134 RLVSNVVYKANIRPICIMWDASWKHHIDSI-KVLTGTGWGRTESMH-DSSE---LRTLDISRQPS 193
            :|...:.:.|||:.|.::  ..:...||.: .|.|..|:|.||..: |.||   ...::|.....
  Fly   128 QLPEPLTFSANIQAIQLV--GQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNAD 190

  Fly   194 KMCAFGS--VLSNQFCAGNWNS---NLCIGDTGGPVGAMVRYRNAF-RFVQVGI--AITNKRC-- 248
            .:..:|.  |:.:..||..::.   :.|.||:|||   ::.|.... ::.|:||  .:...:|  
  Fly   191 CVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGP---LILYNKTIQQWQQIGINSFVAEDQCTY 252

  Fly   249 QRPSVFTDVMSHIEFI 264
            :.||.:..|.|.:.||
  Fly   253 RLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 65/243 (27%)
Tryp_SPc 43..267 CDD:238113 66/244 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 65/243 (27%)
Tryp_SPc 38..271 CDD:238113 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.