DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and spirit

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:122/277 - (44%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IVNGKVAVRNSSPWMAFLHTSSN-----QFICGGTLISRRLVLTAAHCF-----IPNTTIVVRLG 97
            :|.|........|:||.|...||     .:.|||.||:...|||||||.     .|:.   ||||
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQ---VRLG 193

  Fly    98 EYNRKL-KGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHID 161
            ..|..| :|  |:..:.|...|..|..:|..||||||.|  ....|..::|.||     |.....
  Fly   194 GDNLTLTEG--EDISIRRVIIHPDYSASTAYNDIALLEL--ETAAKPELKPTCI-----WTQKEV 249

  Fly   162 SIKVLTGTGWGRTE-SMHDSSELRTLDISRQPSKMC---------AFGSVLSNQFCAGN--WNSN 214
            :..::|..|:|:|. :...|::|..:.:....::.|         |.| ||..|.|||:  ...:
  Fly   250 TNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQG-VLGTQMCAGDITGERD 313

  Fly   215 LCIGDTGGPV---GAMVRYRNAFRFVQVGIAITNKRCQR--PSVFTDVMSHIEFIRRI-FLTQNG 273
            .|.||:|||:   ..::.|       .|||....:.|..  |||:|.|.|.:::|..| :..|..
  Fly   314 TCQGDSGGPLLMQDGLLGY-------VVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQV 371

  Fly   274 NDRNQPTPKPDKEPEFD 290
            .:..||.......||||
  Fly   372 TNAPQPNQMTSFSPEFD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 77/248 (31%)
Tryp_SPc 43..267 CDD:238113 78/251 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 78/251 (31%)
Tryp_SPc 132..361 CDD:214473 77/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.