DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG33458

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:280 Identity:99/280 - (35%)
Similarity:150/280 - (53%) Gaps:25/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISR 76
            ||:|.....||.:..|:.:||..   |...||..|:.:....:||:|:||.:| :|||||:|::.
  Fly    10 LLILGHGISLGYSYLLEWDCGIS---KYTYRITGGRDSPLMLNPWLAYLHINS-KFICGGSLLNH 70

  Fly    77 RLVLTAAHCF-IPNTTIVVRLGEYNRKLK---------GYREEHQVNRTFQHRFYDPNTHANDIA 131
            ..|||||||| ..|..::|||||.:...|         ....|:.:.:...|..| ...|..|||
  Fly    71 WFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY-RTAHYYDIA 134

  Fly   132 LLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC 196
            |.:|...|||..:|||||:|.:.:|:.::|:|:....||||.|.:...|.:|:...|.:.....|
  Fly   135 LAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTC 199

  Fly   197 A--FGSVLS-NQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQRP----SVF 254
            .  ||.::. ...|||.....:..||:|||:|:||.|:.|.||.|.||.   ...::|    |||
  Fly   200 RYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIV---SHLRQPFHGVSVF 261

  Fly   255 TDVMSHIEFIRRIFLTQNGN 274
            |:::|:..:|.|..:|.:|:
  Fly   262 TNILSYSNWIHRTIITNSGH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 86/238 (36%)
Tryp_SPc 43..267 CDD:238113 86/240 (36%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 86/238 (36%)
Tryp_SPc 38..274 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.