DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG30323

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:308 Identity:65/308 - (21%)
Similarity:106/308 - (34%) Gaps:87/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGT 72
            |..:||||    |..|....:.:.|.:..|.:........|::|...   ...|...|.| |.|:
  Fly     1 MQFLLLLL----LTSSAYSNEGKKGLQRNLYVTDNYHQNVVSIRTRK---HIRHWGDNHF-CAGS 57

  Fly    73 LISRRLVLTAAHCFI--PNTT-----------IVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPN 124
            |:|...|:|:..|..  |.:|           :||...:..:|.......|     .|....|.:
  Fly    58 LLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYH-----VQKIVLDES 117

  Fly   125 --THANDIALLRLVSNVVYK--ANIRPICIMWDASWKHHIDSIKVLTGTGWGRT----------- 174
              :...::|||:|...|..:  |.:.|         :..::|..:....||||.           
  Fly   118 AISGCTELALLKLDRGVTGQRFAMMLP---------EKELNSTWLCNSLGWGRIYYVSYVYISAM 173

  Fly   175 ----ESMHD-----------SSEL---RTLDISRQPSKM-CAFGSVLSNQFCAGNW--NSNLCIG 218
                ..::|           ||||   |...||....|. |      |...|..::  ..|:|..
  Fly   174 CPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDC------SRCLCMTSYTGRGNMCQQ 232

  Fly   219 DTGGPVGAMVRYRNAFRFVQVGIAITNKRCQRPS--VFTDVMSHIEFI 264
            |.|.|:     :.:.|.:   |:|.....|....  .:|::..:.:||
  Fly   233 DLGSPL-----FCDHFLY---GVARRVHTCDDEGFMFYTNIYQNRKFI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 54/272 (20%)
Tryp_SPc 43..267 CDD:238113 56/273 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 54/257 (21%)
Tryp_SPc 45..272 CDD:214473 52/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.