DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG30288

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:297 Identity:86/297 - (28%)
Similarity:139/297 - (46%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EIVVIGMASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQ 66
            ::|::....|.::.|     .|.:.|:::|||.|......||..|:.|...|:|||..: ..|.:
  Fly     7 QLVIVACLFIGIIRT-----ESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRV-MISGK 65

  Fly    67 FICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPN------- 124
            .:|||:||:.|.||||.||..| ..:.||||||:.:               |..:|.:       
  Fly    66 AVCGGSLITARFVLTAEHCISP-MYMNVRLGEYDTR---------------HPIFDCDDFVCTPR 114

  Fly   125 ----------THAN---DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTES 176
                      .|:|   ||.|||:..:|::...:||||::...:...:..||.....||||....
  Fly   115 AYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSD 179

  Fly   177 MHDSSELRTLDISRQPSKMCAF-GSVLS-NQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQV 239
            ..:...|:|..:.:.|...|.. |..|. :..|||::.|:.|.||:|||:.|:..:....|..|.
  Fly   180 GEEQDRLQTATLQQLPQWSCERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQF 244

  Fly   240 GIAITNKR-CQRPSVFTDVMSHIEFIRRIFLTQNGND 275
            |:|....| |....::|:|....::|  :.:.||.:|
  Fly   245 GVASQGLRLCSGLGIYTNVTHFTDWI--LDVIQNHSD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 73/244 (30%)
Tryp_SPc 43..267 CDD:238113 73/246 (30%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 73/244 (30%)
Tryp_SPc 45..270 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.