DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG30187

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:285 Identity:96/285 - (33%)
Similarity:143/285 - (50%) Gaps:21/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHC 85
            :|::.|||..||....||    |..|..|...:|.|||.:|..:: ||||||||.:|.|||||||
  Fly    18 VGASIFLDQICGINIALK----ITGGHNAAFQNSVWMAAVHNRTH-FICGGTLIHKRFVLTAAHC 77

  Fly    86 FIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPN-THANDIALLRLVSNVVYKANIRPIC 149
            .:......|.||.||:.....|::  |.....|..:|.. ::.|||.||:|.|:|::.|.|||||
  Fly    78 IVDQDVQSVSLGAYNKSDPADRKD--VITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPIC 140

  Fly   150 IMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC-----AFGSVLSNQFCAG 209
            |:.:.|..:|:.:::.....|||.......|..|:|:.::....:.|     .:.|  ..|.|||
  Fly   141 IVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPS--EKQICAG 203

  Fly   210 NWNSNLCIGDTGGPVGAMVRYRN-AFRFVQVGIAITNK-RCQRPSVFTDVMSHIEFIRRIFLTQN 272
            ..:.:.|.||:|||:...|..:. ..|.||.||....| .|....|:||:||..::|:......:
  Fly   204 VPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYTDLMSFADWIKMTIERLS 268

  Fly   273 GNDRNQPTP----KPDKEPEFDWNN 293
            ..|..|..|    .|.::..|.:|:
  Fly   269 IEDEPQSAPFYKIIPQQQDVFLYND 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 81/229 (35%)
Tryp_SPc 43..267 CDD:238113 82/231 (35%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 82/233 (35%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.