DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG30090

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:285 Identity:110/285 - (38%)
Similarity:158/285 - (55%) Gaps:23/285 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLTVFPLLGSTQFLDSECG-TRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISR 76
            |.:.|...||:.::|:..|| |.:.:..  :|:.|:.|:.||:||||::| ||.:.|||||||::
  Fly    11 LAIGVLCSLGNGEYLEPRCGLTANTIAF--KIIGGRDAIINSNPWMAYIH-SSVKLICGGTLITQ 72

  Fly    77 RLVLTAAHCFIPNTTIVVRLGEY--------NRKLKGYR-EEHQVNRTFQHRFYDPNTHANDIAL 132
            |.|||||||....:.:.||||||        |.|:...| |||.|:..|:|..:....:.|||||
  Fly    73 RFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIAL 137

  Fly   133 LRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC- 196
            |||...|.:||:|.||||:...|.:..:|||:....||||.|.:......|:...:.|..|..| 
  Fly   138 LRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCM 202

  Fly   197 -AFGS-VLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVG-IAITNKRCQRPSVFTDVM 258
             |.|. |..||.|||...|:.|.||:|||:...||:.:..|.||.| ::..::.|....|:|||.
  Fly   203 QALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVY 267

  Fly   259 SHIEFIRRIFLTQNGNDRNQPTPKP 283
            |:.::|..:.      .:|...|.|
  Fly   268 SYADWIATVV------QQNTHVPAP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 98/234 (42%)
Tryp_SPc 43..267 CDD:238113 99/236 (42%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 98/234 (42%)
Tryp_SPc 40..276 CDD:238113 99/236 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463283
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.