DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG30087

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:260 Identity:90/260 - (34%)
Similarity:143/260 - (55%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLVLTAAHCFIPN 89
            |||:..||.....:...|:||||.||..|:|:|.:: |:::...|||::::.|.:||||||..||
  Fly    24 QFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYV-TNNSLTHCGGSILNSRYILTAAHCVFPN 87

  Fly    90 TTIVVRLGEYNRK----LKGYR-----EEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANI 145
              :.:||||:|.:    .:|..     ||:.:.:...||||:...|.||||||:|..::.:..:|
  Fly    88 --LRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHI 150

  Fly   146 RPICIMWDASWKHHIDSIKVLTGTGWGRTES-----MHDSSELRTLDISRQPSKMCAFGSVLSNQ 205
            :||||:.:.:   ...|:......|||.|:.     :..::|||..|.:.......|:  :..||
  Fly   151 QPICILLNPA---SAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAY--MNGNQ 210

  Fly   206 FCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR-CQRPSVFTDVMSHIEFIRRIFL 269
            .|||:...:.|.||:|||:...|.:....|::|:||...... ||.|.|:|.|.::|.:|||..|
  Fly   211 ICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAML 275

  Fly   270  269
              Fly   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 81/236 (34%)
Tryp_SPc 43..267 CDD:238113 82/238 (34%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 81/236 (34%)
Tryp_SPc 42..272 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463305
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.