DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and T22A3.6

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:177 Identity:37/177 - (20%)
Similarity:59/177 - (33%) Gaps:52/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AFLHTSSNQFI-------CGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRT 115
            :|..|.|.:|:       |..|..|.|:.....:.:..:|..|...    ||..|.......:|.
 Worm    22 SFTRTFSQKFVNVSISDDCETTEESERIFGYRTNFYSDDTGNVFCF----RKKDGSIRMSSTSRF 82

  Fly   116 FQHRFYDPNTHANDIAL--LRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMH 178
            |:    ||....:..::  .|...||.:|.  || |:.|                      .|:.
 Worm    83 FE----DPRFMCSKGSMDWYRGKKNVDFKD--RP-CLFW----------------------SSIP 118

  Fly   179 DSSELRTLDISRQPSKMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVG 225
            :|    |.|||...|...:...:|.:::      .|.|......|:|
 Worm   119 NS----TFDISDSSSSSYSMNRILPDEY------ENFCRNPDKNPLG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 37/177 (21%)
Tryp_SPc 43..267 CDD:238113 37/177 (21%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.