DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and try-10

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:230 Identity:55/230 - (23%)
Similarity:86/230 - (37%) Gaps:52/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ICGGTLISRRLVLTAAHCFIPN----TTIVVRLGE--YNRKLKGYREEHQVNRTFQHRFYDPNTH 126
            :|||.||:..:|:|:|||....    .|..|.||:  .|:...|.:|..........:|::..:.
 Worm   103 VCGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKFFNDASE 167

  Fly   127 AND---------------------IALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTG 170
            |||                     ||.|....:|.:|.......:..:.|         |....|
 Worm   168 ANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETS---------VCYVAG 223

  Fly   171 WGRTES----MHDSSELRTLDIS-RQPSKMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRY 230
            ||:||:    ..||.....:::| |:..|.    ..|..:...|  :|..|:||:|.||...|..
 Worm   224 WGKTENKTAKYSDSVRQMMVNLSVRRIGKR----KYLIAKAVTG--SSRACMGDSGSPVYCFVNG 282

  Fly   231 RNAFRFVQVGIAITNKRCQRPSVFTDVMSHIEFIR 265
            :.........|...:|..::     |..:||.|.|
 Worm   283 KRILVGTVAHIGSFSKMSEQ-----DPSNHISFCR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 53/227 (23%)
Tryp_SPc 43..267 CDD:238113 55/230 (24%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 48/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.