DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG43742

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:294 Identity:94/294 - (31%)
Similarity:142/294 - (48%) Gaps:38/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLI 74
            |:||:..|.......|.||..|    .:|:..|:.||..|:  :|.:||.|:.:| :|.|||:||
  Fly     6 SLLLVAVVIYQNAFAQLLDENC----KVKITYRVANGHTAI--TSQFMAALYNNS-EFFCGGSLI 63

  Fly    75 SRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVN---RTFQHRFYDPNTHANDIALLRLV 136
            .::.|||||||......:.|.|||.||.......:|.:.   :...|..:..|...||||||||.
  Fly    64 HKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLE 128

  Fly   137 SNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSV 201
            ..|:::|:||||||:.|.....  ::....|..|||:||..:.|..|..:|:.|.|..|| :.::
  Fly   129 REVIFEAHIRPICIILDEDVTS--NNQNNFTAYGWGKTEHGNISDVLSFIDLVRLPKSMC-YQNI 190

  Fly   202 LSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGI-AITNKRCQRP-SVFTDVMSHIEFI 264
              |..|||:.:.:.|..|:|||:.....:|...|.:..|| :..:..|... .|:|||.::..:|
  Fly   191 --NTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWI 253

  Fly   265 RRIFLTQNGNDRNQPTPKPDKEPEF-------DW 291
            ..:.|              :.||..       ||
  Fly   254 ASVVL--------------ESEPRLLNEYCKSDW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 79/226 (35%)
Tryp_SPc 43..267 CDD:238113 79/228 (35%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 79/226 (35%)
Tryp_SPc 35..256 CDD:238113 79/228 (35%)
Tryp_SPc 273..467 CDD:214473 1/1 (100%)
Tryp_SPc 273..>368 CDD:304450 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463429
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.