DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG43335

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:273 Identity:89/273 - (32%)
Similarity:147/273 - (53%) Gaps:15/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ASILLLLTVFPLL---GSTQFLDSECGTRS-PLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFIC 69
            |:.|::::|...|   |.::.|:..||.|: |.....||:.|..|...|.||||:|:...:.| |
  Fly     4 AAFLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYF-C 67

  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLG------EYNRKLKGYREEHQVNRTFQHRFYDPNTHAN 128
            .||||:.:.|||||||...:..:.||||      ......:...|::.|:...:|:::.|:...|
  Fly    68 AGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLN 132

  Fly   129 DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPS 193
            |||::||...|.:..:||||||:.|.:.:..::....|..||||..:.......|:...|:....
  Fly   133 DIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNR 197

  Fly   194 KMCA---FGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGI-AITNKRCQRPSVF 254
            .:|:   ..::...|.|||:..:|.|:||:|||:|.:|.|....||||.|| :..:..|:.||::
  Fly   198 NVCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIY 262

  Fly   255 TDVMSHIEFIRRI 267
            ||:.::..:|..:
  Fly   263 TDLSTYSGWINMV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 78/231 (34%)
Tryp_SPc 43..267 CDD:238113 78/233 (33%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 78/231 (34%)
Tryp_SPc 42..275 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463284
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.