DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and CG43124

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:298 Identity:79/298 - (26%)
Similarity:115/298 - (38%) Gaps:82/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSS--PWMAFLHTSSNQFICGGTL 73
            |:|.:.:....||.|.|:.:|            |:....:..||  ||:|.: .|.::.||.|.|
  Fly     7 IVLCIVLMFYQGSAQTLEEDC------------VDHMERINGSSYAPWLAEI-LSDSKVICAGAL 58

  Fly    74 ISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGY----REEHQVNRTFQHRFYDPNTHANDIALLR 134
            |:...|||||.||..|..:.||||      .||    .|..:|.:.:....:.|..:.|::.:.|
  Fly    59 INNLYVLTAASCFKENEKLTVRLG------SGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFR 117

  Fly   135 LVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFG 199
            |.:.|.:|.:|||:||                       |:|........|.:|..:..||..|.
  Fly   118 LQTEVEFKTHIRPMCI-----------------------TKSPKSLGLATTFEIINEKPKMWYFC 159

  Fly   200 SVLSNQFC-------AGNWNSNLCIGDTG---------GPVGAMVRYRNAFRFVQVGIAITNKRC 248
            ..:...||       ...|.|.    .||         ||...:|||         ||.......
  Fly   160 KNIKGLFCKYVFGENEEKWQSK----PTGSPWTETISNGPFKGLVRY---------GILSYRDNK 211

  Fly   249 QRPSVFTDVMSHIEFIRRIFLTQNGNDRNQPTPKPDKE 286
            ....|:.:|||||.:|.:|.|     :.:..||...||
  Fly   212 TYDEVYINVMSHINWIAQISL-----EIDISTPVKKKE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 65/243 (27%)
Tryp_SPc 43..267 CDD:238113 66/245 (27%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 34/98 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.