powered by:
Protein Alignment CG18420 and LOC1278509
DIOPT Version :10
| Sequence 1: | NP_995715.1 |
Gene: | CG18420 / 2768924 |
FlyBaseID: | FBgn0028866 |
Length: | 299 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_061507124.1 |
Gene: | LOC1278509 / 1278509 |
VectorBaseID: | AGAMI1_001581 |
Length: | 356 |
Species: | Anopheles gambiae |
| Alignment Length: | 65 |
Identity: | 15/65 - (23%) |
| Similarity: | 21/65 - (32%) |
Gaps: | 29/65 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1498 FVQCAKKEEQKDITPVNPCVPS-----------PCG------------------PNSNCRTVGSQ 1533
|.:.|.|..|.|:|.:...||| |.| |:.:.||..:|
Mosquito 103 FSKKAPKNAQLDVTSLVRLVPSSFDNVQFIKKGPMGAYIYSDGGSQKSSQFEAIPSMSTRTTDTQ 167
Fly 1534 1533
Mosquito 168 167
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG18420 | NP_995715.1 |
Tryp_SPc |
42..264 |
CDD:214473 |
|
| LOC1278509 | XP_061507124.1 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
