DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18420 and Mcpt1l1

DIOPT Version :9

Sequence 1:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001264597.1 Gene:Mcpt1l1 / 100360872 RGDID:2321286 Length:260 Species:Rattus norvegicus


Alignment Length:303 Identity:69/303 - (22%)
Similarity:125/303 - (41%) Gaps:91/303 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSN---QFIC 69
            |.::|.|:.:        .|.|..|..       .|:.|..:..:|.|:||.|..::.   :..|
  Rat     1 MQALLFLMAL--------LLPSGAGAE-------EIIGGVESRPHSRPYMAHLEITTERGYKATC 50

  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLR 134
            ||.|::|:.|:|||||....||:.:.:.:.: |.:..:::.:|.:...|..|:..::.:||.||:
  Rat    51 GGFLVTRQFVMTAAHCKGRETTVTLGVHDVS-KTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLK 114

  Fly   135 LVSNVVYKANIRPICIMWDASWKHHIDSI------------KVLTGTGWGRTESMHDSSELRTLD 187
            |..    ||.:.|.           :|.|            |:....|||:|.....:|  .||.
  Rat   115 LQK----KAKVTPA-----------VDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTS--NTLR 162

  Fly   188 ISRQPSKMCAFGSVLSNQFCAG----NWNSNLCI-----------GDTGGPVGAMVRYRNAFRFV 237
            ..:|        .::..:.|..    |:|..:|:           ||:|||:            |
  Rat   163 EVKQ--------RIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPL------------V 207

  Fly   238 QVGIA---ITNKR--CQRPSVFTDVMSHIEFIRRIFLTQNGND 275
            ..|:|   ::..|  .:.|:|||.:..::.:|.::.   .|.|
  Rat   208 CAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVI---KGKD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 60/256 (23%)
Tryp_SPc 43..267 CDD:238113 61/258 (24%)
Mcpt1l1NP_001264597.1 Tryp_SPc 20..239 CDD:214473 60/256 (23%)
Tryp_SPc 21..242 CDD:238113 61/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.