DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and TMPRSS13

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001070731.1 Gene:TMPRSS13 / 84000 HGNCID:29808 Length:567 Species:Homo sapiens


Alignment Length:271 Identity:76/271 - (28%)
Similarity:111/271 - (40%) Gaps:61/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFI 89
            ||.     ||:|..:.   ||:.|..|..:..||.|.||..| ..:|||:||..:.||||||||.
Human   314 CSH-----CGLRAMTG---RIVGGALASDSKWPWQVSLHFGT-THICGGTLIDAQWVLTAAHCFF 369

  Fly    90 ANQHLVARLGEYERTRSEECTGY--YCNFREEHMVDAGFK------HKLYDPNTHANDIAILRLS 146
            .             ||.:...|:  |......|.:.....      :..|.......|||::|||
Human   370 V-------------TREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRLS 421

  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDA-------LQTLDIRRQPPD 204
            |.:....:|.|.|:.. |.....|:  :....||:|||:...|..:       :..:|.::    
Human   422 KPLTLSAHIHPACLPM-HGQTFSLN--ETCWITGFGKTRETDDKTSPFLREVQVNLIDFKK---- 479

  Fly   205 VCAKFI--GQTIAGNQFCAGNW----DSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC- 262
             |..::  ...:.....|||:.    ||  |.|||||||   :..:| .|:...|:.|: ...| 
Human   480 -CNDYLVYDSYLTPRMMCAGDLRGGRDS--CQGDSGGPL---VCEQN-NRWYLAGVTSW-GTGCG 536

  Fly   263 --QKASVFTDV 271
              .|..|:|.|
Human   537 QRNKPGVYTKV 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/252 (28%)
Tryp_SPc 45..278 CDD:238113 70/251 (28%)
TMPRSS13NP_001070731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
13 X 5 AA repeats of A-S-P-A-[GLQR] 9..93
4 X 5 AA repeats of T-P-P-G-R 14..68
DUF3682 16..>87 CDD:289231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157
SRCR_2 231..320 CDD:292133 4/10 (40%)
Tryp_SPc 325..554 CDD:214473 71/252 (28%)
Tryp_SPc 326..557 CDD:238113 70/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.