DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and prss60.1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:400 Identity:110/400 - (27%)
Similarity:153/400 - (38%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTT-DMFVCGGSL 75
            :.::|..|..||..:     .||:...:.   ||:.|..|...|.||.|.|||.. ....|||||
Zfish     9 LALLLCVQGSHSQLN-----VCGLAPLNN---RIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSL 65

  Fly    76 ITDKLVLTAAHCF--IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN 138
            |..:.|||||||.  |....|:..||   :|..:....|..|    ..|.....|..|:..|:.|
Zfish    66 INSEWVLTAAHCLPRITTSSLLVFLG---KTTQQGVNTYEIN----RTVSVITVHPSYNNLTNEN 123

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDH--------RWRHYLDKIDLLTATGWGKTQMESDSDA--- 192
            |||:|.||.:|.:.:.|||:|:...:        .|           .||||..|:..:..|   
Zfish   124 DIALLHLSSAVTFSNYIRPVCLAAQNSVFPNGTSSW-----------ITGWGNIQLGVNLPAPGI 177

  Fly   193 LQTLDIRRQPPDVCAKFIGQ-TIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            ||...|...|.|.|...:|. ::..|..|||  ....:.|.||||||:    ..|....:||.||
Zfish   178 LQETMIPVVPNDQCNALLGSGSVTNNMICAGLLQGGRDTCQGDSGGPM----VSKQCLVWVQSGI 238

  Fly   255 AS--YTNRNCQKASVFTDVLSHAEFI--LRVWRMYG------------KGQTLP----IP----- 294
            .|  |...:.....|:|.|..:..:|  :.|..:.|            ...|||    :|     
Zfish   239 TSWGYGCADPYSPGVYTRVSQYQSWINSIIVQNLPGFVLFNSSSTCSSVSMTLPNSTALPTSSIS 303

  Fly   295 -------------------KKPPTTT----------RPPTWWHTTRIPKQTFQDYDY----DTNH 326
                               .|||||:          |||:...:....|:..:.||.    :.|:
Zfish   304 TASPTTTTTTKISTISSASTKPPTTSQTSTTTTTNLRPPSNQTSISCRKRCGEKYDIRNRCNCNN 368

  Fly   327 GSH----WDW 332
            ..|    ||:
Zfish   369 RCHKNCCWDY 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 82/252 (33%)
Tryp_SPc 45..278 CDD:238113 81/251 (32%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 82/252 (33%)
Tryp_SPc 34..267 CDD:238113 82/254 (32%)
Somatomedin_B 349..382 CDD:295334 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.