DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and cfbl

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001077327.1 Gene:cfbl / 792472 ZFINID:ZDB-GENE-030131-2319 Length:751 Species:Danio rerio


Alignment Length:254 Identity:67/254 - (26%)
Similarity:93/254 - (36%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KYNSSPWMVFL---HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYY 113
            |....||:..:   .||.....|.||.:|...:|||||||..:........:.|    .|..|..
Zfish   471 KRRQYPWLAKISVTRSTGKNSKCMGSFVTSSFILTAAHCFKVDDTPATITIDLE----SENQGIK 531

  Fly   114 CNFREEHMVDAGFKHKLY--DPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL- 175
            ..:...| .|...|.||.  .|..:..|:|:|:|.|.|....::||||:.........|...|. 
Zfish   532 VKYIHSH-PDYNIKAKLNLGIPEYYEFDVALLQLEKPVKMSVSLRPICIPCTKETNGALRLSDRE 595

  Fly   176 --------LTATGWG---------KTQMESDSDALQTLDIRRQPPDVCAKFIGQT-------IAG 216
                    |..||..         :|:.|.....::...:|:...:...|..|.|       :..
Zfish   596 GTCKKHKELLMTGETVKAAFMSEVRTKTEQKDITIKQGKLRQACVEDAKKAAGMTAEKATDIVTD 660

  Fly   217 NQFCAGNWDSN----LCNGDSGG-----PLGAVITHKNTQRFVQVGIASYTNRNCQKAS 266
            |..|:|..|..    .|.|||||     |.|         |.|||||.|:..::..|.|
Zfish   661 NFLCSGGIDPTTDEIACKGDSGGATFVVPGG---------RVVQVGIVSWGVKDLCKRS 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/254 (26%)
Tryp_SPc 45..278 CDD:238113 67/254 (26%)
cfblNP_001077327.1 CCP 87..142 CDD:214478
CCP 149..202 CDD:153056
vWFA 250..445 CDD:294047
Tryp_SPc 471..720 CDD:214473 67/254 (26%)
Tryp_SPc 471..720 CDD:238113 67/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.