back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18636 and mettl7a

DIOPT Version :9

Sequence 1:	NP_995714.2	Gene:	CG18636 / 2768923	FlyBaseID:	FBgn0032551	Length:	349	Species:	Drosophila melanogaster
Sequence 2:	NP_001072195.1	Gene:	mettl7a / 779641	XenbaseID:	XB-GENE-5802614	Length:	245	Species:	Xenopus tropicalis

Alignment Length:	72	Identity:	14/72 - (19%)
Similarity:	20/72 - (27%)	Gaps:	36/72 - (50%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 FQLLHSGCS----------QFLDP-------ACGIR-------------------TQSRTAYRII 46
            |.|.|..||          :.|:|       .|.:|                   .|:||..:.:
Frog   171 FFLEHVACSDEATWLCFFQRILNPTWKLVFDGCNLRKFTWKDLENAKFSTLKLRHIQARTMIKPV 235

  Fly    47 NGHTAKY 53
            ..|...|
Frog   236 TPHIVGY 242

Known Domains:

Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.