DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and st14b

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:288 Identity:78/288 - (27%)
Similarity:121/288 - (42%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPACGIRT---------------QSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGS 74
            |...|:|.|...|               :...:.||:.|..:.....||.|.||..|...|||.|
Zfish   590 CISKLNPMCDGETDCVDGSDEAECKCGKKPHKSSRIVGGKDSDEGEWPWQVSLHMKTQGHVCGAS 654

  Fly    75 LITDKLVLTAAHCFIANQHL--------VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY 131
            :|::..::|||||...|...        ...||.:.:..:.:.|        :..|.....|..|
Zfish   655 VISNSWLVTAAHCVQDNDQFRYSQADQWEVYLGLHNQGETSKST--------QRSVLRIIPHPQY 711

  Fly   132 DPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS--DALQ 194
            |.:::.||||::.|...|....||.|||:...   .||......:..|||||.:..||:  ..||
Zfish   712 DHSSYDNDIALMELDSPVTLNQNIWPICLPDP---THYFPAGKSVWITGWGKLREGSDAVPSVLQ 773

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            ..::|.....||:|.:...|..:..|||  :...:.|.||||||:.::   :...|....|:.|:
Zfish   774 KAEVRIINSTVCSKLMDDGITPHMICAGVLSGGVDACQGDSGGPMSSI---EGNGRMFLAGVVSW 835

  Fly   258 TN----RNCQKASVFTDVLSHAEFILRV 281
            .:    ||  :..|:|.|..:..:|..:
Zfish   836 GDGCGRRN--RPGVYTRVTDYRSWIREI 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/249 (29%)
Tryp_SPc 45..278 CDD:238113 71/248 (29%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060 5/22 (23%)
Tryp_SPc 624..858 CDD:214473 72/249 (29%)
Tryp_SPc 625..861 CDD:238113 72/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.