DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss36

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:347 Identity:93/347 - (26%)
Similarity:131/347 - (37%) Gaps:89/347 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIAN 91
            :|.|..||   :...:.||:.|..|...:.||.|.||.... .:||||||....||:|||||:.|
Mouse    33 EFEDLDCG---RPEPSSRIVGGSDAHPGTWPWQVSLHQGGG-HICGGSLIAPSWVLSAAHCFVTN 93

  Fly    92 ------QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN-----DIAILRL 145
                  ..|...||.:.:....|         ..||....   .:..|:.::.     |:|:|||
Mouse    94 GTLEPADELSVLLGVHSQDGPLE---------GAHMRSVA---TILIPDNYSTVELGADLALLRL 146

  Fly   146 SKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQ-----------MESD-----SDALQ 194
            :.......::||:|:   .|..|.........|||||..|           .|.:     ..|.|
Mouse   147 ASPAKLGPSVRPVCL---PRASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQ 208

  Fly   195 TLDIRRQPPDVCAKFI-GQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY- 257
            .|..|..|.::..:.: |...||  :.||..|:  |.|||||||    ..::..|:...||.|: 
Mouse   209 CLYSRPGPFNLTFQLLPGMLCAG--YPAGRRDT--CQGDSGGPL----VCEDGGRWFLAGITSFG 265

  Fly   258 ---TNRNCQKASVFTDVLSHAEFILR---------------------VWRMYGKGQTLPIPK--K 296
               ..||  :..|||.|..:..:|..                     .|....:..|...|:  |
Mouse   266 FGCGRRN--RPGVFTAVAPYESWIREHVMGSEPGPVFPSQLQKPQSGPWEPREENCTFAQPECGK 328

  Fly   297 PPTTTRPPTW-WHT-TRIPKQT 316
            .|   ||.|| |.. ..:|..|
Mouse   329 AP---RPGTWPWEAQVTVPGST 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/265 (29%)
Tryp_SPc 45..278 CDD:238113 75/264 (28%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 76/267 (28%)
Tryp_SPc 331..532 CDD:389826 7/17 (41%)
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.