DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss8

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:293 Identity:87/293 - (29%)
Similarity:127/293 - (43%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGC-SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTD-MFVCGGS 74
            |.|:|:..||.||. :...:.:||...|.    ||..|.:||....||.|.:  |.| ..|||||
Mouse    15 VTILLLLGLLQSGIRADGTEASCGAVIQP----RITGGGSAKPGQWPWQVSI--TYDGNHVCGGS 73

  Fly    75 LITDKLVLTAAHCFIANQH----LVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNT 135
            |:::|.|::||||| ..:|    ...:||.::       ...|.|....|.|.....|..|....
Mouse    74 LVSNKWVVSAAHCF-PREHSREAYEVKLGAHQ-------LDSYSNDTVVHTVAQIITHSSYREEG 130

  Fly   136 HANDIAILRLSKSVVYRDNIRPICV-VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT---- 195
            ...|||::|||..|.:...|||||: ..:..:.:.|.    .|.||||..   :.|.:|||    
Mouse   131 SQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLH----CTVTGWGHV---APSVSLQTPRPL 188

  Fly   196 --LDIRRQPPDVCAKFIG--------QTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQR 248
              |::.....:.|:....        .||..:..|||  ....:.|.|||||||...:    ...
Mouse   189 QQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPM----EGI 249

  Fly   249 FVQVGIASYTNRNC---QKASVFTDVLSHAEFI 278
            :...||.|:.:. |   .:..|:|...::|.:|
Mouse   250 WYLAGIVSWGDA-CGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/258 (29%)
Tryp_SPc 45..278 CDD:238113 75/257 (29%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 76/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.