DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss12

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_898932.2 Gene:Tmprss12 / 75002 MGIID:1922252 Length:336 Species:Mus musculus


Alignment Length:268 Identity:92/268 - (34%)
Similarity:126/268 - (47%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAY---RIINGHTAKYNSSPWMVFLHSTTD---MFVCGGSLITDKLVLTAAHCF-IA 90
            ||| ...|.|.   |||.|..|...:.||.|.|.....   |.||||:|:.|:.|||||||. .|
Mouse    52 CGI-APLRGAVEGSRIIGGSQADTGAWPWQVSLQVQDGDILMHVCGGALVRDRWVLTAAHCTKEA 115

  Fly    91 NQHLVAR--LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPN----THANDIAILRLSKSV 149
            ...|..|  :|..:.|||.    |:.  |...:.|.     :..|:    |..||||:.||.::|
Mouse   116 RDPLKWRAVMGTNDLTRSP----YHS--RNIRITDI-----IIPPDFIMETFVNDIALFRLKRAV 169

  Fly   150 VYRDNIRPICVVWDHRWRHYLDKIDLLTA---TGWGKTQMESD-SDALQTLDIRRQPPDVCAKFI 210
            .|.|.|:|||:.:.     ...|:|..||   :|||:|:.|.: :..||...:.....:||:...
Mouse   170 RYNDYIQPICLPFG-----VFQKLDQNTACFISGWGRTREEGNGTTILQEAKVHFISREVCSSDQ 229

  Fly   211 GQT--IAGNQFCAGN----WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFT 269
            |.:  |....||||:    :||  |.|||||||...:...:  |:..:||.|| ...|.:.. |.
Mouse   230 GYSGMIPNTSFCAGHENGTFDS--CRGDSGGPLMCYLPEHS--RYFVMGITSY-GHGCGRRH-FP 288

  Fly   270 DVLSHAEF 277
            .|.|:..|
Mouse   289 GVYSNPSF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 87/254 (34%)
Tryp_SPc 45..278 CDD:238113 86/253 (34%)
Tmprss12NP_898932.2 Tryp_SPc 65..300 CDD:214473 87/254 (34%)
Tryp_SPc 66..300 CDD:238113 86/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.